PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI08G17710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 369aa    MW: 38456.8 Da    PI: 8.0537
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI08G17710.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding506.8e-1683128147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l ++v+++G+ +W++Ia ++  gR++k+c++rw++ 
  ORUFI08G17710.1  83 RGHWRPAEDAKLRELVALYGPQNWNLIADKLD-GRSGKSCRLRWFNQ 128
                      899*****************************.***********996 PP

2Myb_DNA-binding52.21.4e-16136178246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +++ eE+e+l  a++ +G++ W+ Iar ++ gRt++ +k++w+ 
  ORUFI08G17710.1 136 RPFSDEEEERLMAAHRFYGNK-WAMIARLFP-GRTDNAVKNHWHV 178
                      68*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.59978129IPR017930Myb domain
SMARTSM007179.9E-1482131IPR001005SANT/Myb domain
SuperFamilySSF466891.27E-2783176IPR009057Homeodomain-like
PfamPF002491.9E-1583128IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2584136IPR009057Homeodomain-like
CDDcd001676.08E-1386127No hitNo description
PROSITE profilePS5129424.91130184IPR017930Myb domain
SMARTSM007174.9E-13134182IPR001005SANT/Myb domain
PfamPF002498.3E-13135177IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-20137183IPR009057Homeodomain-like
CDDcd001678.98E-11137177No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MPCTSAAWML HVGGAAAEQA SSSSSSKGGG RVVTAGTTTM DTGGYNNGGG GGGGGGNGRG  60
GGDHQESSSS GGGGGQSSRL AARGHWRPAE DAKLRELVAL YGPQNWNLIA DKLDGRSGKS  120
CRLRWFNQLD PRISKRPFSD EEEERLMAAH RFYGNKWAMI ARLFPGRTDN AVKNHWHVIM  180
ARKYREQSTA YRRRKLNQAV QRKLDATTAS DVVVAHHHPY AAAHDPYAFT FRHYCFPFPA  240
ASPAAADEPP FTCLFPGTAA TAGRGGGGGM TWPDAMAAGE VIDDGAGGGR YVVAEPPPPF  300
LVPAAPHGWL GGHEMMVMVN DGGDVAAGVA SSYDGMIGRD QGGGGSHFEA AAAAAAAPAF  360
IDFLGVGAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-33831837107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0057570.0AP005757.2 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0413H11.
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649302.11e-178PREDICTED: uncharacterized protein LOC4345661
TrEMBLA0A0E0QJF50.0A0A0E0QJF5_ORYRU; Uncharacterized protein
STRINGLOC_Os08g33800.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.12e-70myb domain protein 105